PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa34577s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 70aa    MW: 7589.73 Da    PI: 10.6376
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa34577s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind152.29e-47170227296
       GAGA_bind 227 nGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnk 296
                     +GGWqS+CCt++iS+yPLP+st+r+gaR+agrKmS+ga+ klL++La+eGy+ls+pvDLk+hWA+HGtnk
  Csa34577s010.1   1 MGGWQSSCCTISISTYPLPMSTTRPGARLAGRKMSNGAYVKLLARLAGEGYSLSHPVDLKNHWARHGTNK 70 
                     6********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.7E-6170IPR010409GAGA-binding transcriptional activator
PfamPF062177.0E-41270IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MGGWQSSCCT ISISTYPLPM STTRPGARLA GRKMSNGAYV KLLARLAGEG YSLSHPVDLK  60
NHWARHGTNK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0899617e-90EU089961.1 Arabidopsis arenosa GAGA-binding transcriptional activator (BBR/BPC7) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010516733.11e-45PREDICTED: protein BASIC PENTACYSTEINE7-like
SwissprotO822869e-46BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLR0HUS96e-45R0HUS9_9BRAS; Uncharacterized protein
STRINGAT2G35550.14e-43(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.45e-47basic pentacysteine 7